PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009793846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 327aa    MW: 36232.4 Da    PI: 9.4365
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009793846.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-32198254158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh hA++R RgsgGrF
  XP_009793846.1 198 DGPVYVNAKQYHGILRRRQMRAKLEAQNKL-VKARKPYLHESRHLHAVKRVRGSGGRF 254
                     57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.1E-37196257IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.033197257IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.6E-27200254IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-23200222IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860202222IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.0E-23231254IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAVRAQALPN RSLEQTSTCF VPHFAVNSST WWSSNEVQSS QSLPKNLTSE VVFQPPPCQQ  60
MKPLGLGLQG DDSYSTQSNS NSPLEVTALG KTGSQDQCAS SGSVHDESYK RNKQAQIKTN  120
PFIRYPEYPT DCSQSEMAHS ISHAPFGYSD PYLSGFYAAY GPHVFSQNSF SSDIWSIQPQ  180
MIGIAPARVP LPLDLAEDGP VYVNAKQYHG ILRRRQMRAK LEAQNKLVKA RKPYLHESRH  240
LHAVKRVRGS GGRFLSTKKL QESIPNDLNS SQDLVTREAH TSAFLSVRQD AAHNSVIFQQ  300
QQHDHRASSL SSHMAVSMQS SRSTGIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-19200259463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793846.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_009793847.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_009793848.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_009793849.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_009793850.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
TrEMBLK4DBZ32e-97K4DBZ3_SOLLC; Uncharacterized protein
STRINGSolyc12g009050.1.16e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.42e-44nuclear factor Y, subunit A8